Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NF-YA
Protein Properties Length: 220aa    MW: 24013.5 Da    PI: 9.6475
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                     +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh+hA++R+Rg+gGrF 116 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHQHAMKRARGTGGRF 172
                                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.6E-39114175IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.351115175IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.3E-29117172IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.5E-25118140IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860120140IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.5E-25149172IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985516.11e-120PREDICTED: nuclear transcription factor Y subunit A-7 isoform X2
SwissprotQ9LVJ72e-42NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLK4AEG21e-120K4AEG2_SETIT; Uncharacterized protein
STRINGSi037269m1e-119(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.13e-34nuclear factor Y, subunit A6